Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

MLLLVAPEQEPVQSTAPLFTERCPAGFPSPAADYTEEELDLNAYCIRRPAATFFVRAIGD
SMKEMGLHSGDLMVVDKAEKPMQGDIVIAETDGEFTVKRLQLKPRIALLPINPAYPTLYP
EELQIFGVVTAFIHKTRSTD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by family S24 unassigned peptidases (S24.UPW) cleavage. RCPA-GFPS.