Chymase (Chymase 1, mast cell) (Fragment)
|
UniProt : B5BUM8, P23946, UniProt ID: B5BUM8_HUMAN, CMA1_HUMAN, Chymase (Chymase 1, mast cell) (Fragment) Homo sapiens MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI NQILQAN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Chymase (Chymase 1, mast cell) (Fragment) contains a PF00089 domain.
Chymase (Chymase 1, mast cell) (Fragment) is proteolytically cut by chymase (S01.140) cleavage. PSQF-NFVP.