Chymase (Chymase 1, mast cell) (Fragment)

UniProt : B5BUM8, P23946, UniProt ID: B5BUM8_HUMAN, CMA1_HUMAN,

Chymase (Chymase 1, mast cell) (Fragment)

Homo sapiens

MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chymase (Chymase 1, mast cell) (Fragment) contains a PF00089 domain.

Chymase (Chymase 1, mast cell) (Fragment) is proteolytically cut by chymase (S01.140) cleavage. PSQF-NFVP.