Mannose-binding protein A

UniProt : P19999, UniProt ID: MBL1_RAT,

Mannose-binding protein A

Rattus norvegicus

MLLLPLLVLLCVVSVSSSGSQTCEETLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGP
PGKLGPPGSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTLKSKLELTNKLHAFSM
GKKSGKKFFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEV
TEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mannose-binding protein A contains a PF00059 domain.

Mannose-binding protein A contains a PF01391 domain.

Mannose-binding protein A is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. GLRG-LQGP.

Mannose-binding protein A is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. KLAN-MEAE.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-QKGD.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPKG-QKGD.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPPG-KLGP.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-KLGP.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPPG-SVGA.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KLAN-MEAE.

Mannose-binding protein A is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KLAN-MEAE.