C. albicans pH regulated cell wall protein Phr2p

UniProt : Q5AB91, UniProt ID: Q5AB91_CANAL,

C. albicans pH regulated cell wall protein Phr2p

Candida albicans

MLLKSLFPSILAATSFVSSVAAEDLPAIEIVGNKFFYSNNGSQFYIKGIAYQQNNLDSNE
SFVDPLANPEHCKRDIPYLEAVDTNVIRVYALDTSQDHTECMQMLQDAGIYVIADLSQPD
ESINRDDPSWDLDLFERYTSVVDLFHNYTNILGFFAGNEVTNKKSNTDASAFVKAAIRDT
KAYIKSKGYRSIPVGYSANDDSAIRVSLADYFACGDEDEAADFFGINMYEWCGDSSYKAS
GYESATNDYKNLGIPIFFSEYGCNEVRPRKFTEVATLFGDQMTPVWSGGIVYMYFEEENN
YGLVSIKDNTVSTLKDYSYYSSEIKDIHPSSAKASAESASSISRTTCPTNTNNWEASTNL
PPTPDKEVCECMSASLKCVVDDKVDSDDYSDLFSYICAKIDCDGINANGTTGEYGAYSPC
HSKDKLSFVMNLYYEQNKESKSACDFGGSASLQSAKTASSCSAYLSSAGSSGLGTVSGTV
RTDTSQSTSDSGSGSSSSSSSSSSSSSSGSSGSKSAASIVSVNLLTKIATIGISIVVGFG
LITM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C. albicans pH regulated cell wall protein Phr2p contains a PF03198 domain.

C. albicans pH regulated cell wall protein Phr2p contains a PF07983 domain.

C. albicans pH regulated cell wall protein Phr2p is proteolytically cut by kexin (S08.070) cleavage. HCKR-DIPY.