Calcium/calmodulin-dependent protein kinase type IV

UniProt : Q16566, UniProt ID: KCC4_HUMAN,

Calcium/calmodulin-dependent protein kinase type IV

Homo sapiens

MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Calcium/calmodulin-dependent protein kinase type IV contains a PF00069 domain.

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by calpain-2 (C02.002) cleavage..

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by calpain-2 (C02.002) cleavage..

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by caspase-3 (C14.003) cleavage. YWID-GSNR.

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by caspase-3 (C14.003) cleavage. PAPD-APLK.

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by calpain-1 (C02.001) cleavage. EN-LVPD.

Calcium/calmodulin-dependent protein kinase type IV is proteolytically cut by calpain-1 (C02.001) cleavage. TVCG-TPGY.