Collagen alpha-6(IV) chain

UniProt : Q14031, UniProt ID: CO4A6_HUMAN,

Collagen alpha-6(IV) chain

Homo sapiens

MLINKLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGP
TGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLD
GITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPG
PRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGN
PGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI
GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSG
FCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSG
PKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGE
KGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIP
GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEK
GLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSG
LPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISG
HPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG
SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRR
PMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPP
GFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS
PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGE
PGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPA
GLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGD
PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGE
LGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPG
PLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQG
PPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEG
QEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQ
IPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVS
PGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTR
VSRCQVCMKSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01413 domain.

Collagen alpha-6(IV) chain contains a PF01413 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain contains a PF01391 domain.

Collagen alpha-6(IV) chain is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..