NEDD8

UniProt : Q15843, UniProt ID: NEDD8_HUMAN,

NEDD8

Homo sapiens

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

NEDD8 contains a PF00240 domain.

NEDD8 is proteolytically cut by SENP8 peptidase (C48.011) cleavage. LRGG-GGLR.