NEDD8
|
UniProt : Q15843, UniProt ID: NEDD8_HUMAN, NEDD8 Homo sapiens MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK ILGGSVLHLVLALRGGGGLRQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
NEDD8 contains a PF00240 domain.
NEDD8 is proteolytically cut by SENP8 peptidase (C48.011) cleavage. LRGG-GGLR.