LGALS3 protein (HCG22119, isoform CRA_a)

UniProt : Q6IBA7, UniProt ID: Q6IBA7_HUMAN,

LGALS3 protein (HCG22119, isoform CRA_a)

Homo sapiens

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

LGALS3 protein (HCG22119, isoform CRA_a) contains a PF00337 domain.

LGALS3 protein (HCG22119, isoform CRA_a) is proteolytically cut by bacterial collagenase (Vibrio-type) (M09.001) cleavage..