Acyl-coenzyme A:Isopenicillin N acyltransferase (IPN:acyltransferase)

UniProt : P15802, Q3HUS0, UniProt ID: AAAA_PENCH, Q3HUS0_PENCH,

Acyl-coenzyme A:Isopenicillin N acyltransferase (IPN:acyltransferase)

Penicillium chrysogenum

MLHILCQGTPFEIGYEHGSAAKAVIARSIDFAVDLIRGKTKKTDEELKQVLSQLGRVIEE
RWPKYYEEIRGIAKGAERDVSEIVMLNTRTEFAYGLKAARDGCTTAYCQLPNGALQGQNW
DFFSATKENLIRLTIRQAGLPTIKFITEAGIIGKVGFNSAGVAVNYNALHLQGLRPTGVP
SHIALRIALESTSPSQAYDRIVEQGGMAASAFIMVGNGHEAFGLEFSPTSIRKQVLDANG
RMVHTNHCLLQHGKNEKELDPLPDSWNRHQRMEFLLDGFDGTKQAFAQLWADEDNYPFSI
CRAYEEGKSRGATLFNIIYDHARREATVRLGRPTNPDEMFVMRFDEEDERSALNARL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Acyl-coenzyme A:Isopenicillin N acyltransferase (IPN:acyltransferase) contains a PF03417 domain.

Acyl-coenzyme A:Isopenicillin N acyltransferase (IPN:acyltransferase) is proteolytically cut by acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase precursor (C45.001) cleavage. ARDG-CTTA.