Surfactant associated protein D

UniProt : Q6IRS7, UniProt ID: Q6IRS7_RAT,

Surfactant associated protein D

Rattus norvegicus

MLHFLSMLVLLVQPLGDLGAEMKTLSQRSITNTCTLVLCSPTENGLPGRDGRDGREGPRG
EKGDPGLPGPMGLSGLPGPRGPVGPKGENGSAGEPGPKGERGLVGPPGSPGISGPAGKEG
PSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGAKGPAGPKGERGAPGEQGAPGNAG
AAGPAGPAGPQGAPGSRGPPGLKGDRGAPGDRGIKGESGLPDSAALRQQMEALNGKLQRL
EAAFSRYKKAALFPDGQSVGDKIFRAANSEEPFEDAKEMCRQAGGQLASPRFATENAAVQ
QLVTAHSKAAFLSMTDVGTEGKFTYPTGEALVYSNWAPGEPNNNGGAENCVEIFTNGQWN
DKACGEQRLVICEF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Surfactant associated protein D contains a PF00059 domain.

Surfactant associated protein D contains a PF01391 domain.

Surfactant associated protein D contains a PF01391 domain.

Surfactant associated protein D contains a PF01391 domain.

Surfactant associated protein D contains a PF09006 domain.

Surfactant associated protein D is proteolytically cut by pseudolysin (M04.005) cleavage. GSPG-ISGP.

Surfactant associated protein D is proteolytically cut by pseudolysin (M04.005) cleavage. DGQS-VGDK.

Surfactant associated protein D is proteolytically cut by pseudolysin (M04.005) cleavage. IFRA-ANSE.

Surfactant associated protein D is proteolytically cut by pseudolysin (M04.005) cleavage. TEGK-FTYP.

Surfactant associated protein D is proteolytically cut by pseudolysin (M04.005) cleavage. VYSN-WAPG.