cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2)

UniProt : A8K7B6, P20248, UniProt ID: A8K7B6_HUMAN, CCNA2_HUMAN,

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2)

Homo sapiens

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2) contains a PF00134 domain.

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2) contains a PF02984 domain.

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2) is proteolytically cut by omptin (A26.001) cleavage. PKTR-RVAP.

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2) is proteolytically cut by omptin (A26.001) cleavage. PKTR-RVAP.

cDNA FLJ77347, highly similar to Homo sapiens cyclin A2 (CCNA2), mRNA (Cyclin A2) is proteolytically cut by calpain-3 (C02.004) cleavage..