Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA)
|
UniProt : A4D158, P01303, UniProt ID: A4D158_HUMAN, NPY_HUMAN, Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) Homo sapiens MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) contains a PF00159 domain.
Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) is proteolytically cut by meprin beta subunit (M12.004) cleavage. NPGE-DAPA.
Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) is proteolytically cut by meprin beta subunit (M12.004) cleavage. APAE-DMAR.
Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) is proteolytically cut by dipeptidyl peptidase IV (S09.008) cleavage..
Neuropeptide Y (cDNA, FLJ92442, Homo sapiens neuropeptide Y (NPY), mRNA) is proteolytically cut by aminopeptidase P2 (M24.005) cleavage. ---Y-PSK-.