Integrin beta-2

UniProt : P05107, UniProt ID: ITB2_HUMAN,

Integrin beta-2

Homo sapiens

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Integrin beta-2 contains a PF00362 domain.

Integrin beta-2 contains a PF08725 domain.

Integrin beta-2 contains a PF07974 domain.

Integrin beta-2 contains a PF07965 domain.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. MNPK-FAES.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. NPKF-AES-.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. PKFA-ES--.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. KFAE-S---.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. MNPK-FAES.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. NPKF-AES-.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. PKFA-ES--.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. KFAE-S---.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. EKLK-SQWN.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. NPLF-KSAT.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. TTVM-NPKF.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. MNPK-FAES.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. NPKF-AES-.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. PKFA-ES--.

Integrin beta-2 is proteolytically cut by cathepsin X (C01.013) cleavage. KFAE-S---.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. EKLK-SQWN.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. NPLF-KSAT.

Integrin beta-2 is proteolytically cut by calpain-2 (C02.002) cleavage. TTVM-NPKF.

Integrin beta-2 is proteolytically cut by Sat peptidase (S06.004) cleavage..