Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA)

UniProt : P25445, Q5T9P1, UniProt ID: Q5T9P1_HUMAN, TNR6_HUMAN,

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA)

Homo sapiens

MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) contains a PF00531 domain.

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) contains a PF00020 domain.

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) contains a PF00020 domain.

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ETQN-LEGL.

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ETQN-LEGL.

Fas (TNF receptor superfamily, member 6) (Fas (TNF receptor superfamily, member 6), isoform CRA_e) (cDNA FLJ77106, highly similar to Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KGLE-LRKT.