cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA
UniProt : B2RC38, P17931, UniProt ID: B2RC38_HUMAN, LEG3_HUMAN, cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA Homo sapiens MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP GAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNL PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI DLTSASYTMI The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA contains a PF00337 domain.
cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PPGA-YHGA.
cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PPGA-YHGA.
cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. PPGA-YHGA.
cDNA, FLJ95838, Homo sapiens lectin, galactoside-binding, soluble, 3 (galectin 3)(LGALS3), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PPGA-YHGA.