Rattus norvegicus

MLGFSISPAECQTPSIYDDVESTREGQEASLRPTVELNESKSPDKPNPRGFPGKPCANNS
DTLELPASSEALLLGWVPTRLVPAIYGLVVVVGLPANGLALWVLATRVPRLPSTILLMNL
AVADLLLALVLPPRLVYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLAAVSLDRYLAL
VHPLRARALRGQRLTTILCLVAWLSAATLVLPLTFHRQTFLLAGSDRMLCHDALPLAEQT
SHWRPAFICLAVLGCFVPLLAMVLCYGATLRALAANGQRYSHAVRLTALVLFSAVAAFTP
SNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFREKVRAMLCRQ
LKASSSSQASREAGSRGTAICSSTLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by trypsin 1 (S01.151) cleavage. TVEL-NESK.

is proteolytically cut by trypsin 1 (S01.151) cleavage. NESK-SPDK.

is proteolytically cut by trypsin 1 (S01.151) cleavage. PNPR-GFPG.

is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PNPR-GFPG.

is proteolytically cut by kallikrein hK14 (S01.029) cleavage. NPRG-FPGK.

is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PNPR-GFPG.

is proteolytically cut by kallikrein hK6 (S01.236) cleavage. NPRG-FPGK.

is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PNPR-GFPG.

is proteolytically cut by kallikrein hK5 (S01.017) cleavage. NPRG-FPGK.