KLLA0C14047p

UniProt : Q6CTB1, UniProt ID: Q6CTB1_KLULA,

KLLA0C14047p

Kluyveromyces lactis

MLFTNLIAGASILGAAVASPIHGHKDNKRDLVYVTNRVTSTVVVYGDAPMTLAGASTTVA
LDADHIPTEATSPISYADVTRGDAAPTEAVSTTADAPESTSSTSSSTSSGSASSSSAASP
DFGSGFKGITYSPYTDGGACKSAQQVASDLASLSSYGVIRLYGVDCNQVENVFQGKASGQ
KLFLGVYFMDQIEAGVEQIASAVNSYGSWDDVVAVSIGNELVNSGASVDTVSSYVSTGRA
ALTSAGYTGPVVSVDTFTALIANPSLCDCNDFVAVNAHAYFDQNTAAEDAGSWLMNQIER
VWGTCNGNKQVVITESGWPSQGQTYGKAVPSKENQKIAIESIKKTCGDATILFTAFNDYW
KADGAWGVEKYWGVLSSE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLLA0C14047p contains a PF00332 domain.

KLLA0C14047p is proteolytically cut by kexin (S08.070) cleavage. DNKR-DLVY.