cDNA FLJ75978, highly similar to Homo sapiens ornithine carbamoyltransferase (OTC), mRNA (Ornithine carbamoyltransferase, isoform CRA_a)

UniProt : A8K9P2, P00480, UniProt ID: A8K9P2_HUMAN, OTC_HUMAN,

cDNA FLJ75978, highly similar to Homo sapiens ornithine carbamoyltransferase (OTC), mRNA (Ornithine carbamoyltransferase, isoform CRA_a)

Homo sapiens

MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQ
EHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKEN
GTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75978, highly similar to Homo sapiens ornithine carbamoyltransferase (OTC), mRNA (Ornithine carbamoyltransferase, isoform CRA_a) contains a PF02729 domain.

cDNA FLJ75978, highly similar to Homo sapiens ornithine carbamoyltransferase (OTC), mRNA (Ornithine carbamoyltransferase, isoform CRA_a) contains a PF00185 domain.

cDNA FLJ75978, highly similar to Homo sapiens ornithine carbamoyltransferase (OTC), mRNA (Ornithine carbamoyltransferase, isoform CRA_a) is proteolytically cut by () cleavage..