Mannoprotein MP65

UniProt : Q9HEP1, UniProt ID: Q9HEP1_CANAL,

Mannoprotein MP65

Candida albicans

MLFKSFVTFTVLANALAAPLAHQHHQHKEEKRAVHVVTTTNVVVVTIGNGDQTTTFAAPS
VAADSSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGG
VGSGGAKGITYSPYSDNGGCKSSSQIASEIAQLSGFNVIRLYGVDCDQVAAVLIAKTSSQ
KIFAGIFDVSSITSGIESLAEAVKSICGSWDDIYTVSIGNELVNAGSATPSQIKAYVEEG
RKALKAAGYTGPVVSVDTFIAVINNPDLCDYSDYMAVNAHAFFDGHVAAENSGAWVLQQI
QRVWTACGGKKNVLITETGWPSRGDSNGVAVPSKSNQQAAISSIKSSCGASAILFTAFND
LWKADGPYNAEKYWGIYSN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mannoprotein MP65 is proteolytically cut by kexin (S08.070) cleavage. EEKR-AVHV.