cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b)

UniProt : A8K4S6, O00629, UniProt ID: A8K4S6_HUMAN, IMA4_HUMAN,

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b)

Homo sapiens

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF00514 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) contains a PF01749 domain.

cDNA FLJ76805, highly similar to Homo sapiens karyopherin alpha 4 (importin alpha 3) (KPNA4), mRNA (Karyopherin alpha 4 (Importin alpha 3), isoform CRA_b) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. ICED-SDID.