Spike glycoprotein (Fragment)

UniProt : P17662, UniProt ID: SPIKE_IBVD3,

Spike glycoprotein (Fragment)

Avian infectious bronchitis virus (strain D3896)

MLEKSLLLVTLLFALCSANLFGNNSYVYYYQSAFRPPNGWHLHGGAYEVVNVSTESSNAG
TTECTAGAIYWSKNFSAASVAMTAPQNGMLWSTAQFCTAHCNFTDFVVFVTHCYKSASGS
CPLTGLIPQYHIRISAMKNSSLFYNLTVAVTKYPRFKSLQCVNNMTSVYLNGDLVFTSNE
TKDVSAAGVHFKAGGPITYKVMREVKALAYFVNGTAQDVILCDGSPTGLLACQYNTGNFS
DGFYPFTNSSLVKEKFIVYRESSVNTTLELTNFTFSNVSNANPNTGGVHTIQLYQTSTAQ
SGHYNFNFSFLSSFTYKESDYMYGSYHPSCKFRLETINNGLWFNSLSVSLGYGPIQGGCK
QSVFQNRATCCYAYSYNGPPLCKGVYRGELTKSFECGLLVFVTKTDGSRIQTRNEPFTLT
QHNYNNITLDRCVEYNIYGRVGQGFITNVTNYAINYNYLADGGMAILDTSGAIDIFVVQG
EYGLNYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQPLENQFYIKIINGTRRSRRSI
TGNVTNCPYV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Spike glycoprotein (Fragment) contains a PF01600 domain.

Spike glycoprotein (Fragment) is proteolytically cut by (S08) cleavage. RSRR-SITG.