C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b)

UniProt : A3KFJ3, P00519, UniProt ID: A3KFJ3_HUMAN, ABL1_HUMAN,

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b)

Homo sapiens

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) contains a PF00017 domain.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) contains a PF00018 domain.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) contains a PF07714 domain.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) contains a PF08919 domain.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. DTTD-VPEM.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. DTTD-VPEM.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase () cleavage. SLVD-AVNS.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. DTTD-VPEM.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase () cleavage. SLVD-AVNS.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. EHRD-TTDV.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-6 (C14.005) cleavage..

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-7 (C14.004) cleavage..

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. REMD-GQPE.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. SLVD –AVNS.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. SLVD –AVNS.

C-abl oncogene 1, receptor tyrosine kinase (V-abl Abelson murine leukemia viral oncogene homolog 1, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. DTTD-VPEM.