Caspase-1

UniProt : P89116, UniProt ID: CASP1_SPOFR,

Caspase-1

Spodoptera frugiperda

MLDGKQDNGNVDSVDIKQRTNGGGDEGDALGSNSSSQPNRVARMPVDRNAPYYNMNHKHR
GMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAE
MDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQG
DRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEEL
RYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase-1 contains a PF00656 domain.

Caspase-1 is proteolytically cut by caspase (insect 1) (C14.015) cleavage. DEGD-ALGS.

Caspase-1 is proteolytically cut by caspase (insect 1) (C14.015) cleavage. DRLD-GGIT.

Caspase-1 is proteolytically cut by caspase (insect 1) (C14.015) cleavage. TETD-GSPS.