Nidogen-1

UniProt : P10493, UniProt ID: NID1_MOUSE,

Nidogen-1

Mus musculus

MLDASGCSWAMWTWALLQLLLLVGPGGCLNRQELFPFGPGQGDLELEAGDDVVSPSLELI
GELSFYDRTDITSVYVTTNGIIAMSEPPATEYHPGTFPPSFGSVAPFLADLDTTDGLGNV
YYREDLSPFIIQMAAEYVQRGFPEVSFQPTSVVVVTWESVAPYGGPSSSPAEEGKRNTFQ
AVLASSNSSSYAIFLYPEDGLQFFTTFSKKDESQVPAVVGFSKGLVGFLWKSNGAYNIFA
NDRESIENLAKSSNAGHQGVWVFEIGSPATAKGVVSADVNLDLDDDGADYEDEDYDLVTS
HLGLEDVATPSPSHSPRRGYPDPHNVPRILSPGYEATERPRGVPTERTRSFQLPAERFPQ
HHPQVIDVDEVEETGVVFSYNTGSQQTCANNRHQCSVHAECRDYATGFCCRCVANYTGNG
RQCVAEGSPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIPETVGY
SLLPLAPIGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFLGHPGKLVLKQQFSGIDE
HGHLTISTELEGRVPQIPYGASVHIEPYTELYHYSSSVITSSSTREYTVMEPDQDGAAPS
HTHIYQWRQTITFQECAHDDARPALPSTQQLSVDSVFVLYNKEERILRYALSNSIGPVRD
GSPDALQNPCYIGTHGCDSNAACRPGPGTQFTCECSIGFRGDGQTCYDIDECSEQPSRCG
NHAVCNNLPGTFRCECVEGYHFSDRGTCVAAEDQRPINYCETGLHNCDIPQRAQCIYMGG
SSYTCSCLPGFSGDGRACRDVDECQHSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCMPG
EVSKTRCQLEREHILGAAGGADAQRPTLQGMFVPQCDEYGHYVPTQCHHSTGYCWCVDRD
GRELEGSRTPPGMRPPCLSTVAPPIHQGPVVPTAVIPLPPGTHLLFAQTGKIERLPLERN
TMKKTERKAFLHIPAKVIIGLAFDCVDKVVYWTDISEPSIGRASLHGGEPTTIIRQDLGS
PEGIALDHLGRTIFWTDSQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTD
WNRDNPKIETSHMDGTNRRILAQDNLGLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPG
RRKVLEGLQYPFAVTSYGKNLYYTDWKTNSVIAMDLAISKEMDTFHPHKQTRLYGITIAL
SQCPQGHNYCSVNNGGCTHLCLPTPGSRTCRCPDNTLGVDCIERK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nidogen-1 contains a PF07645 domain.

Nidogen-1 contains a PF07645 domain.

Nidogen-1 contains a PF07474 domain.

Nidogen-1 contains a PF06119 domain.

Nidogen-1 contains a PF00086 domain.

Nidogen-1 contains a PF00058 domain.

Nidogen-1 contains a PF00058 domain.

Nidogen-1 contains a PF00058 domain.

Nidogen-1 contains a PF00008 domain.

Nidogen-1 contains a PF00008 domain.

Nidogen-1 contains a PF00008 domain.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EPTT-IIRQ.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GRAS-LNGG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VVFS-YNTG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. KTNS-VIAM.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VAPP-IHQG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NPRG-IVTD.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FLAD-LDTT.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GLGN-VYYR.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SIEN-LAKS.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SHLG-LEDV.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GRAS-LHGG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SPEG-IALD.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EVAK-MDGT.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DNLG-LPNG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EPTT-IIRQ.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GRAS-LNGG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VVFS-YNTG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. KTNS-VIAM.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VAPP-IHQG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NPRG-IVTD.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FLAD-LDTT.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GLGN-VYYR.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SIEN-LAKS.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SHLG-LEDV.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GRAS-LHGG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SPEG-IALD.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EVAK-MDGT.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DNLG-LPNG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. RAQC-IYMG.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LIGE-LSFY.

Nidogen-1 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. SPDA-LQNP.