Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a)

UniProt : A0N0L5, P08887, UniProt ID: A0N0L5_HUMAN, IL6RA_HUMAN,

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a)

Homo sapiens

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a) contains a PF00041 domain.

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a) contains a PF09240 domain.

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a) contains a PF00047 domain.

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a) is proteolytically cut by aminopeptidase PILS (M01.018) cleavage..

Interleukin 6 receptor (Interleukin 6 receptor, isoform CRA_a) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. LPVQ-DSSS.