Carboxypeptidase B1 (Tissue) (Carboxypeptidase B1 (Tissue), isoform CRA_a)

UniProt : P15086, Q53XJ0, UniProt ID: CBPB1_HUMAN, Q53XJ0_HUMAN,

Carboxypeptidase B1 (Tissue) (Carboxypeptidase B1 (Tissue), isoform CRA_a)

Homo sapiens

MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Carboxypeptidase B1 (Tissue) (Carboxypeptidase B1 (Tissue), isoform CRA_a) contains a PF00246 domain.

Carboxypeptidase B1 (Tissue) (Carboxypeptidase B1 (Tissue), isoform CRA_a) contains a PF02244 domain.

Carboxypeptidase B1 (Tissue) (Carboxypeptidase B1 (Tissue), isoform CRA_a) is proteolytically cut by cationic trypsin (S01.127) cleavage. SRVR-ATGH.