Extracellular superoxide dismutase [Cu-Zn]
|
UniProt : P08294, UniProt ID: SODE_HUMAN, Extracellular superoxide dismutase [Cu-Zn] Homo sapiens MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALH AACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGD LSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVV HAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESECKAA The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Extracellular superoxide dismutase [Cu-Zn] contains a PF00080 domain.
Extracellular superoxide dismutase [Cu-Zn] is proteolytically cut by furin (S08.071) cleavage. RKKR-RRES.