Interferon gamma

UniProt : B5BU88, P01579, UniProt ID: B5BU88_HUMAN, IFNG_HUMAN,

Interferon gamma

Homo sapiens

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interferon gamma contains a PF00714 domain.

Interferon gamma is proteolytically cut by gingipain R (C25.001) cleavage..

Interferon gamma is proteolytically cut by gingipain K (C25.002) cleavage..

Interferon gamma is proteolytically cut by gingipain R (C25.001) cleavage..

Interferon gamma is proteolytically cut by gingipain K (C25.002) cleavage..

Interferon gamma is proteolytically cut by neutral protease Npr599 () cleavage..

Interferon gamma is proteolytically cut by inhA g.p. (M06.001) cleavage..

Interferon gamma is proteolytically cut by omptin (A26.001) cleavage. KTGK-RKRS.

Interferon gamma is proteolytically cut by omptin (A26.001) cleavage. FRGR-RASQ.