Oxigen-regulated protein 150 (150 kDa oxygen-regulated protein) (cDNA, FLJ94899, Homo sapiens hypoxia up-regulated 1 (HYOU1), mRNA)

UniProt : A8C1Z0, Q9Y4L1, UniProt ID: A8C1Z0_HUMAN, HYOU1_HUMAN,

Oxigen-regulated protein 150 (150 kDa oxygen-regulated protein) (cDNA, FLJ94899, Homo sapiens hypoxia up-regulated 1 (HYOU1), mRNA)

Homo sapiens

MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Oxigen-regulated protein 150 (150 kDa oxygen-regulated protein) (cDNA, FLJ94899, Homo sapiens hypoxia up-regulated 1 (HYOU1), mRNA) contains a PF00012 domain.

Oxigen-regulated protein 150 (150 kDa oxygen-regulated protein) (cDNA, FLJ94899, Homo sapiens hypoxia up-regulated 1 (HYOU1), mRNA) is proteolytically cut by kexin (S08.070) cleavage. KAKR-AASQ.