Gastricsin

UniProt : P20142, UniProt ID: PEPC_HUMAN,

Gastricsin

Homo sapiens

MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLS
VTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSES
STYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIM
GLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIY
WAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQE
DEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPL
WILGDVFLRSYYSVYDLGNNRVGFATAA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gastricsin contains a PF07966 domain.

Gastricsin contains a PF00026 domain.

Gastricsin is proteolytically cut by gastricsin (A01.003) cleavage. FGDL-SVTY.

Gastricsin is proteolytically cut by gastricsin (A01.003) cleavage. LGEF-LRTH.