GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA)
|
UniProt : P60520, Q6FG91, UniProt ID: GBRL2_HUMAN, Q6FG91_HUMAN, GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) Homo sapiens MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) contains a PF02991 domain.
GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) is proteolytically cut by ATG4 peptidase (C54.003) cleavage. NTFG-F---.
GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) is proteolytically cut by ATG4 peptidase (C54.003) cleavage. NTFG-F---.
GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) is proteolytically cut by autophagin-1 (C54.003) cleavage. NTFG-F.
GABARAPL2 protein (GABA(A) receptor-associated protein-like 2, isoform CRA_b) (cDNA FLJ76520, highly similar to Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA) is proteolytically cut by autophagin-2 (C54.002) cleavage. NTFG-F.