Pepsinogen A

UniProt : A1YM35, UniProt ID: A1YM35_PIG,

Pepsinogen A

Sus scrofa

MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKHFPEAAALI
GDEPLENYLDTEYLGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDS
STFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSSLYYAPFDGIL
GLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNW
VPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS
DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWIL
GDVFIRQYYTVFDRANNKVGLAPVV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pepsinogen A contains a PF07966 domain.

Pepsinogen A contains a PF00026 domain.

Pepsinogen A is proteolytically cut by EspC peptidase (S06.010) cleavage..

Pepsinogen A is proteolytically cut by Pet peptidase (S06.004) cleavage..

Pepsinogen A is proteolytically cut by EspP g.p. (S06.002) cleavage..