Caspase-1

UniProt : P29466, UniProt ID: CASP1_HUMAN,

Caspase-1

Homo sapiens

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase-1 contains a PF00656 domain.

Caspase-1 contains a PF00619 domain.

Caspase-1 is proteolytically cut by caspase-11 (C14.012) cleavage..

Caspase-1 is proteolytically cut by caspase-11 (C14.012) cleavage..

Caspase-1 is proteolytically cut by caspase-1 (C14.001) cleavage. NMQD-SQGV.

Caspase-1 is proteolytically cut by caspase-1 (C14.001) cleavage. WFKD-SVGV.

Caspase-1 is proteolytically cut by caspase-1 (C14.001) cleavage. AVQD-NPAM.

Caspase-1 is proteolytically cut by caspase-1 (C14.001) cleavage. FEDD-AIKK.