Pancreatic secretory trypsin inhibitor

UniProt : P00995, UniProt ID: ISK1_HUMAN,

Pancreatic secretory trypsin inhibitor

Homo sapiens

MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL
CFENRKRQTSILIQKSGPC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pancreatic secretory trypsin inhibitor contains a PF00050 domain.

Pancreatic secretory trypsin inhibitor is proteolytically cut by cationic trypsin (S01.127) cleavage. GCTK-IYDP.