CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment)

UniProt : Q6ICQ6, Q99616, UniProt ID: CCL13_HUMAN, Q6ICQ6_HUMAN,

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment)

Homo sapiens

MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) contains a PF00048 domain.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDA-LNVP.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AQPD-ALNV.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AQPD-ALNV.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDA-LNVP.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. AQPD-ALNV.

CCL13 protein (Chemokine (C-C motif) ligand 13, isoform CRA_b) (Fragment) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. ALNV-PSTC.