CCL11 protein (Chemokine (C-C motif) ligand 11)

UniProt : P51671, Q6I9T4, UniProt ID: CCL11_HUMAN, Q6I9T4_HUMAN,

CCL11 protein (Chemokine (C-C motif) ligand 11)

Homo sapiens

MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CCL11 protein (Chemokine (C-C motif) ligand 11) contains a PF00048 domain.

CCL11 protein (Chemokine (C-C motif) ligand 11) is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. LAGP-ASVP.

CCL11 protein (Chemokine (C-C motif) ligand 11) is proteolytically cut by tryptase beta (S01.015) cleavage..