C-C motif chemokine 8

UniProt : P80075, UniProt ID: CCL8_HUMAN,

C-C motif chemokine 8

Homo sapiens

MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-C motif chemokine 8 contains a PF00048 domain.

C-C motif chemokine 8 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDS-VSIP.

C-C motif chemokine 8 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDS-VSIP.