cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b)

UniProt : B2R4V3, P13500, UniProt ID: B2R4V3_HUMAN, CCL2_HUMAN,

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b)

Homo sapiens

MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) contains a PF00048 domain.

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDA-INAP.

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. QPDA-INAP.

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. MKVS-AALL.

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPDA-INAP.

cDNA, FLJ92229, Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA (Chemokine (C-C motif) ligand 2, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. QPDA-INAP.