Bos taurus

MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL
QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK
QKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL
SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. TQSL-VYPF.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LTDV-ENLH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PLLQ-SWMH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PQSV-LSLS.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. VLSL-SQSK.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. TQSL-VYPF.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LTDV-ENLH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PLLQ-SWMH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PQSV-LSLS.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. VLSL-SQSK.

is proteolytically cut by keratinase () cleavage..

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. TQSL-VYPF.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LTDV-ENLH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PLLQ-SWMH.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PQSV-LSLS.

is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. VLSL-SQSK.

is proteolytically cut by keratinase () cleavage..

is proteolytically cut by cytophagalysin (M43.001) cleavage. YPFP-GPIP.

is proteolytically cut by cytophagalysin (M43.001) cleavage. KEAM-APKH.

is proteolytically cut by polyporopepsin (A01.019) cleavage. LLQS-WMHQ.

is proteolytically cut by polyporopepsin (A01.019) cleavage. AFLL-YQEP.

is proteolytically cut by polyporopepsin (A01.019) cleavage. VLSL-SQSK.

is proteolytically cut by polyporopepsin (A01.019) cleavage. PIQA-FLLY.

is proteolytically cut by chymosin (A01.006) cleavage. VLSL-SQSK.

is proteolytically cut by chymosin (A01.006) cleavage. PLPL-LQSW.

is proteolytically cut by chymosin (A01.006) cleavage. PIQA-FLLY.