Beta-casein

UniProt : P02666, UniProt ID: CASB_BOVIN,

Beta-casein

Bos taurus

MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL
QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK
HKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL
SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-casein contains a PF00363 domain.

Beta-casein is proteolytically cut by collagenase colA (M09.002) cleavage. QTQS-LVYP.

Beta-casein is proteolytically cut by collagenase colA (M09.002) cleavage. ESQS-LTLT.

Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. AFLL-YQEP.

Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. AFLL-YQEP.

Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. VLSL-SQSK.

Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. VLSL-SQSK.

Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. SLTL-TDVE.