Beta-casein
|
UniProt : P02666, UniProt ID: CASB_BOVIN, Beta-casein Bos taurus MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK HKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Beta-casein contains a PF00363 domain.
Beta-casein is proteolytically cut by collagenase colA (M09.002) cleavage. QTQS-LVYP.
Beta-casein is proteolytically cut by collagenase colA (M09.002) cleavage. ESQS-LTLT.
Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. AFLL-YQEP.
Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. AFLL-YQEP.
Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. VLSL-SQSK.
Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. VLSL-SQSK.
Beta-casein is proteolytically cut by phytepsin (A01.020) cleavage. SLTL-TDVE.