cDNA, FLJ96342, Homo sapiens leukemia inhibitory factor (cholinergicdifferentiation factor) (LIF), mRNA (Leukemia inhibitory factor) (Cholinergic differentiation factor)

UniProt : B2RCW7, P15018, UniProt ID: B2RCW7_HUMAN, LIF_HUMAN,

cDNA, FLJ96342, Homo sapiens leukemia inhibitory factor (cholinergicdifferentiation factor) (LIF), mRNA (Leukemia inhibitory factor) (Cholinergic differentiation factor)

Homo sapiens

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96342, Homo sapiens leukemia inhibitory factor (cholinergicdifferentiation factor) (LIF), mRNA (Leukemia inhibitory factor) (Cholinergic differentiation factor) contains a PF01291 domain.

cDNA, FLJ96342, Homo sapiens leukemia inhibitory factor (cholinergicdifferentiation factor) (LIF), mRNA (Leukemia inhibitory factor) (Cholinergic differentiation factor) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..