MucA (Putative uncharacterized protein)

UniProt : P0A276, Q17TZ8, UniProt ID: MUCA_ECOLX, Q17TZ8_ECOLX,

MucA (Putative uncharacterized protein)

Escherichia coli

MKVDIFESSGASRVHSIPFYLQRISAGFPSPAQGYEKQELNLHEYCVRHPSATYFLRVSG
SSMEDGRIHDGDVLVVDRSLTASHGSIVVACIHNEFTVKRLLLRPRPCLMPMNKDFPVYY
IDPDNESVEIWGVVTHSLIEHPVCLR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MucA (Putative uncharacterized protein) contains a PF00717 domain.

MucA (Putative uncharacterized protein) is proteolytically cut by family S24 unassigned peptidases (S24.UPW) cleavage. RISA-GFPS.