Putative uncharacterized protein

UniProt : Q3TZB6, UniProt ID: Q3TZB6_MOUSE,

Putative uncharacterized protein

Mus musculus

MKTVILLVFLWGLSCALPVARYHNTESESSEERTGDLAGSPPPPTNSESSEESQASPEGQ
ANSDHTDSSESGEELGYDRGQYRPAGGLSKSTGTGADKEDDEDDSGDDTFGDEDNDLGPE
EGQWGGPSKLDSDEDSTDTTQSSEDSTSQENSAQDTPSDSKDHDSEDEADSRPEAGDSTQ
DSESEEQRVGGGSEGESSHGDGSEFDDEGMQSDDPESTRSDRGHARMSSAGIRSEESKGD
HEPTSTQDSDDSQSVEFSSRKSFRRSHVSEEDYRGELTDSNSRETQSDSTEDTASKEESR
SESQEDTAESQSQEDSPEGQDPSSESSEEAGEPSQESSSESQEGVTSESRGDNPDNTSQA
GDQEDSESSEEDSLNTFSSSESQSTEEQADSESNESLSLSEESQESAQDGDSSSQEGLQS
QSASTESRSQESQSEQDSRSEEDSDSQDSSRSKEESNSTGSASSSEEDIRPKNMEADSRK
LIVDAYHNKPIGDQDDNDCQDGY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF07263 domain.

Putative uncharacterized protein is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. GMQS-DDPE.