Alpha-hemolysin

UniProt : P09616, UniProt ID: HLA_STAAU,

Alpha-hemolysin

Staphylococcus aureus

MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGM
HKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNE
VAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFK
TILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPN
KASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKW
TDRSSERYKIDWEKEEMTN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-hemolysin contains a PF07968 domain.

Alpha-hemolysin is proteolytically cut by peptidase K (S08.054) cleavage. IGGL-IGAN.

Alpha-hemolysin is proteolytically cut by peptidase K (S08.054) cleavage. GKIG-GLIG.

Alpha-hemolysin is proteolytically cut by peptidase K (S08.054) cleavage. IGAN-VSIG.

Alpha-hemolysin is proteolytically cut by peptidase K (S08.054) cleavage. LIGA-NVSI.