Cathelicidin antimicrobial peptide

UniProt : P49913, UniProt ID: CAMP_HUMAN,

Cathelicidin antimicrobial peptide

Homo sapiens

MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD
LDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGS
FDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cathelicidin antimicrobial peptide contains a PF00666 domain.

Cathelicidin antimicrobial peptide is proteolytically cut by neutrophil elastase (S01.131) cleavage. KRFA-LLGD.

Cathelicidin antimicrobial peptide is proteolytically cut by cathepsin D (A01.009) cleavage. IKDF-LRNL.

Cathelicidin antimicrobial peptide is proteolytically cut by cathepsin D (A01.009) cleavage. LGDF-FRKS.

Cathelicidin antimicrobial peptide is proteolytically cut by myeloblastin (S01.134) cleavage. KRFA-LLGD.

Cathelicidin antimicrobial peptide is proteolytically cut by mirabilysin (M10.057) cleavage..

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. SKEK-IGKE.

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. IGKE-FKRI.

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. EFKR-IVQR.

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. IVQR-IKDF.

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. RIKD-FLRN.

Cathelicidin antimicrobial peptide is proteolytically cut by () cleavage. FLRN-LVPR.

Cathelicidin antimicrobial peptide is proteolytically cut by gastricsin (A01.003) cleavage..