|
Mus musculus MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLR DLVCYCRSRGCKGRERMNGTCRKGHLLYTLCCR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. QEES-LRDL.
is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. QAVS-VSFG.