Defensin-related cryptdin-4

UniProt : P28311, UniProt ID: DEF4_MOUSE,

Defensin-related cryptdin-4

Mus musculus

MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSISFGGQEGSALHEKSLR
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Defensin-related cryptdin-4 contains a PF00879 domain.

Defensin-related cryptdin-4 contains a PF00323 domain.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. QAVS-ISFG.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EGSA-LHEK.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HEKS-LRGL.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. QAVS-ISFG.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EGSA-LHEK.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HEKS-LRGL.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. QAVS-ISFG.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EGSA-LHEK.

Defensin-related cryptdin-4 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HEKS-LRGL.