Cathepsin E

UniProt : P14091, UniProt ID: CATE_HUMAN,

Cathepsin E

Homo sapiens

MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQT
FVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGG
YDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIK
QLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGF
QGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cathepsin E contains a PF07966 domain.

Cathepsin E contains a PF00026 domain.

Cathepsin E is proteolytically cut by cathepsin E (A01.010) cleavage. MIQF-TESC.

Cathepsin E is proteolytically cut by cathepsin E (A01.010) cleavage. NLDM-IQFT.