Alpha gliadin

UniProt : A7LHB3, UniProt ID: A7LHB3_WHEAT,

Alpha gliadin

Triticum aestivum

MKTFLILALLAIVATTATIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQ
QPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPFRPQQPYPQSQPQ
YSQPQQPISQQQQQQQQQQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQV
LQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQPLSQVSFQQ
PLQQYPLGQGSFQPSLQNPQAHGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAP
FGIFGTN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha gliadin contains a PF00234 domain.

Alpha gliadin is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. PPQQ-PYPQ.

Alpha gliadin is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. PQQP-YPQP.

Alpha gliadin is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. PQQP-YPQP.

Alpha gliadin is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. PPQQ-PYPQ.

Alpha gliadin is proteolytically cut by endopeptidase B (C01.024) cleavage..