Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b)

UniProt : A6NFA2, UniProt ID: A6NFA2_HUMAN,

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b)

Homo sapiens

MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLI
SQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMT
GSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQW
HKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLI
HCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIP
GPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRS
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDK
GEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLP
GVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQM
GNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLP
GMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSR
GLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAAS
LKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
GERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGF
CEPASCTMQAGQRAFNKGPDP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) contains a PF01391 domain.

Putative uncharacterized protein COL9A1 (Collagen, type IX, alpha 1, isoform CRA_b) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. FPGR-GIPG.